PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT30514
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 274aa    MW: 31272 Da    PI: 7.1085
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT30514genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.54.2e-5671361129
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
               +ppGfrFhPtdeelv++yL+kkv++kk++l +vik+vd+yk+ePwdL+ k k+   e+++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk++++ ++ 
  EMT30514   7 VPPGFRFHPTDEELVDYYLRKKVASKKIDL-DVIKDVDLYKIEPWDLQdKcKIGMeEQNDWYFFSHKDKKYPTGTRTNRATSAGFWKATGRDKPIYT-NHC 105
               69****************************.9***************943433333556**************************************.999 PP

       NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
               lvg++ktLvfykgrap+g+k+dW+mheyrle
  EMT30514 106 LVGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
               *****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-625156IPR003441NAC domain
PROSITE profilePS5100559.9637156IPR003441NAC domain
PfamPF023658.2E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MDTFSHVPPG FRFHPTDEEL VDYYLRKKVA SKKIDLDVIK DVDLYKIEPW DLQDKCKIGM  60
EEQNDWYFFS HKDKKYPTGT RTNRATSAGF WKATGRDKPI YTNHCLVGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETNEN GATPEEGWVV CRVFKKRVAT VRRMADMSSP CWFDDHGAGG  180
GFMPDLDSPR QLGFAAQQPP MDHALYTGES SATDWRYLDK FVASQLFSHD GTNPKEQATH  240
SNAAVQVFQA ENKHEEALDY ASTSAGGGSA HLWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B4e-52715717166NAC domain-containing protein 19
4dul_A4e-52715717166NAC domain-containing protein 19
1ut7_B4e-52715717166NO APICAL MERISTEM PROTEIN
1ut7_A4e-52715717166NO APICAL MERISTEM PROTEIN
1ut4_B4e-52715717166NO APICAL MERISTEM PROTEIN
1ut4_A4e-52715717166NO APICAL MERISTEM PROTEIN
3swp_D5e-52715720169NAC domain-containing protein 19
3swp_C5e-52715720169NAC domain-containing protein 19
3swp_B5e-52715720169NAC domain-containing protein 19
3swp_A5e-52715720169NAC domain-containing protein 19
3swm_D5e-52715720169NAC domain-containing protein 19
3swm_C5e-52715720169NAC domain-containing protein 19
3swm_B5e-52715720169NAC domain-containing protein 19
3swm_A5e-52715720169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6934240.0JQ693424.1 Brachypodium distachyon SWN3 (SWN3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006647601.11e-142PREDICTED: NAC domain-containing protein 7
SwissprotQ9FWX21e-110NAC7_ARATH; NAC domain-containing protein 7
TrEMBLM8C8910.0M8C891_AEGTA; NAC domain-containing protein 7
STRINGOB02G33070.11e-147(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23703892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-99NAC 007